PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G28110.1
Common NameAtMYB41, MYB41
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 282aa    MW: 31651.6 Da    PI: 5.9026
Description myb domain protein 41
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G28110.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.4e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G+g+W+t ++  g++R++k+c++rw +yl
      AT4G28110.1 14 KGPWTAEEDQKLIDYIRFHGPGNWRTLPKNAGLHRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.33e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  +G++ W++Ia++++ gRt++++k++w+++
      AT4G28110.1  67 RGRFSFEEEETIIQLHSVMGNK-WSAIAARLP-GRTDNEIKNHWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.842965IPR017930Myb domain
SuperFamilySSF466898.99E-3211108IPR009057Homeodomain-like
SMARTSM007171.0E-151363IPR001005SANT/Myb domain
PfamPF002492.4E-161461IPR001005SANT/Myb domain
CDDcd001675.69E-131661No hitNo description
Gene3DG3DSA:1.10.10.607.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129421.00966116IPR017930Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001671.87E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009737Biological Processresponse to abscisic acid
GO:0010200Biological Processresponse to chitin
GO:0016049Biological Processcell growth
GO:0030154Biological Processcell differentiation
GO:0042335Biological Processcuticle development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0080091Biological Processregulation of raffinose metabolic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRSPCCDKN GVKKGPWTAE EDQKLIDYIR FHGPGNWRTL PKNAGLHRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVMGNKWS AIAARLPGRT DNEIKNHWNT HIRKRLVRSG  120
IDPVTHSPRL DLLDLSSLLS ALFNQPNFSA VATHASSLLN PDVLRLASLL LPLQNPNPVY  180
PSNLDQNLQT PNTSSESSQP QAETSTVPTN YETSSLEPMN ARLDDVGLAD VLPPLSESFD  240
LDSLMSTPMS SPRQNSIEAE TNSSTFFDFG IPEDFILDDF MF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30141167108B-MYB
1h8a_C5e-301411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306878570.0
Genevisible253851_at0.0
Expression AtlasAT4G28110-
AtGenExpressAT4G28110-
ATTED-IIAT4G28110-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family. Expression is induced in response to dessication, ABA and salt treatment. Overexpression of Myb41 results in abnormal cuticle development and decreased cell expansion.
Function -- GeneRIF ? help Back to Top
  1. AtMyb41 is involved in distinct cellular processes, including control of primary metabolism and negative regulation of short-term transcriptional responses to osmotic stress.
    [PMID: 19211694]
  2. These results indicate that the phosphorylation of MYB41 by MPK6 is required for the biological function of MYB41 in salt tolerance.
    [PMID: 22575450]
  3. implicate AtMYB41 in the production of aliphatic suberin under abiotic stress conditions
    [PMID: 25060192]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00457DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G28110.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT4G05100(R), AT5G14340(R)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G28110
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196100.0AY519610.1 Arabidopsis thaliana MYB transcription factor (At4g28110) mRNA, complete cds.
GenBankBT0019300.0BT001930.1 Arabidopsis thaliana clone C103440 putative myb family transcription factor (At4g28110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194540.10.0myb domain protein 41
SwissprotQ8GWP01e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLQ9M0J50.0Q9M0J5_ARATH; MYB transcription factor
STRINGAT4G28110.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Maruyama-Nakashita A,Inoue E,Watanabe-Takahashi A,Yamaya T,Takahashi H
    Transcriptome profiling of sulfur-responsive genes in Arabidopsis reveals global effects of sulfur nutrition on multiple metabolic pathways.
    Plant Physiol., 2003. 132(2): p. 597-605
    [PMID:12805590]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  6. Cominelli E,Sala T,Calvi D,Gusmaroli G,Tonelli C
    Over-expression of the Arabidopsis AtMYB41 gene alters cell expansion and leaf surface permeability.
    Plant J., 2008. 53(1): p. 53-64
    [PMID:17971045]
  7. Lippold F, et al.
    AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.
    Plant Physiol., 2009. 149(4): p. 1761-72
    [PMID:19211694]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  9. Hoang MH, et al.
    Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2012. 422(1): p. 181-6
    [PMID:22575450]
  10. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  11. Li-Beisson Y, et al.
    Acyl-lipid metabolism.
    Arabidopsis Book, 2013. 11: p. e0161
    [PMID:23505340]
  12. Kosma DK, et al.
    AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.
    Plant J., 2014. 80(2): p. 216-29
    [PMID:25060192]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]